PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10005834
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 329aa    MW: 36587.6 Da    PI: 6.7664
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10005834genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +++ +v ++G g+W++++++ g++R++k+c++rw +yl
      Lus10005834 14 RGLWTPEEDAKILAYVSLYGIGNWTLVPKKAGLNRCGKSCRLRWTNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding48.91.5e-1568110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++T++E+el++++++  G++ W+ Iar ++ gRt++++k++w++
      Lus10005834  68 DNFTPDEEELIIRLHEAIGSR-WSIIARQLP-GRTDNDVKNYWNT 110
                      68*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-24564IPR009057Homeodomain-like
PROSITE profilePS5129426.29965IPR017930Myb domain
SuperFamilySSF466893.91E-3111108IPR009057Homeodomain-like
SMARTSM007171.2E-141363IPR001005SANT/Myb domain
PfamPF002492.1E-151461IPR001005SANT/Myb domain
CDDcd001677.43E-121761No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129418.99266116IPR017930Myb domain
SMARTSM007178.6E-1566114IPR001005SANT/Myb domain
PfamPF002491.0E-1369110IPR001005SANT/Myb domain
CDDcd001672.89E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGRPPCCDKS NVKRGLWTPE EDAKILAYVS LYGIGNWTLV PKKAGLNRCG KSCRLRWTNY  60
LRPDLKHDNF TPDEEELIIR LHEAIGSRWS IIARQLPGRT DNDVKNYWNT KLKKKLQKIG  120
IDPITHKPIS KIINDFGNIS GINHGNQSAS PFMRKTLNSN NLNNNNNNPM VMNLQSEPSS  180
TTTTASSCSN TTTFMVENNT GCSSDYYFSH TNNSFFNHDY YSSSSASSSS TTPLSSSCQQ  240
YPQTDPLTWK EFLVSDPPTS SSAAANLSEG NGCLDMNERG NIGSNKNINA DDNNEGAASS  300
FVENMLDKER EMMLSQFPQL LDPSSFDY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012083639.11e-106PREDICTED: transcription repressor MYB6
SwissprotQ9LSI71e-94MYB35_ARATH; Transcription factor MYB35
TrEMBLA0A067LL301e-106A0A067LL30_JATCU; MYB family protein
STRINGBra025337.1-P1e-102(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.13e-89MYB family protein